PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009620854.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 265aa    MW: 30078.7 Da    PI: 5.8268
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009620854.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM137.68.1e-43101421128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkk.leleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                     lppGfrF Pt+eelv++yL++k++gk+ l++++vi+ v+iy+++P +Lp+     ++ ++++w+fF++ + ++a+g r++r t++gyWkatg+  
  XP_009620854.1  10 LPPGFRFYPTEEELVDFYLRNKLNGKReLDIQRVIPVVNIYQHNPCQLPEmageGIRDDSEQWFFFIPIQDREARGGRPTRLTTEGYWKATGTPG 104
                     79**********************9998999999***************535555555777********************************** PP

             NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      v+s++++ +g k+t+vfykgrap+g+kt W m+ey++
  XP_009620854.1 105 YVYSSNNRIIGGKRTMVFYKGRAPNGKKTLWKMNEYKA 142
                     ************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.92E-466170IPR003441NAC domain
PROSITE profilePS5100546.71110170IPR003441NAC domain
PfamPF023653.0E-2111141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MEMYDNSNLL PPGFRFYPTE EELVDFYLRN KLNGKRELDI QRVIPVVNIY QHNPCQLPEM  60
AGEGIRDDSE QWFFFIPIQD REARGGRPTR LTTEGYWKAT GTPGYVYSSN NRIIGGKRTM  120
VFYKGRAPNG KKTLWKMNEY KASDGEASAT NSVTNLKLRH EFSLCRVYKK SKCVRAFDRR  180
PTGFGIIEGT VPPQPLNDTG DDVAATPSNQ NISPSKDKNL PALNAYLMES SSSGEEHAPT  240
SQPVETSNDL DFSDVPLWDW DCNFI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-301017017165NO APICAL MERISTEM PROTEIN
1ut4_B2e-301017017165NO APICAL MERISTEM PROTEIN
1ut7_A2e-301017017165NO APICAL MERISTEM PROTEIN
1ut7_B2e-301017017165NO APICAL MERISTEM PROTEIN
3swm_A2e-301017020168NAC domain-containing protein 19
3swm_B2e-301017020168NAC domain-containing protein 19
3swm_C2e-301017020168NAC domain-containing protein 19
3swm_D2e-301017020168NAC domain-containing protein 19
3swp_A2e-301017020168NAC domain-containing protein 19
3swp_B2e-301017020168NAC domain-containing protein 19
3swp_C2e-301017020168NAC domain-containing protein 19
3swp_D2e-301017020168NAC domain-containing protein 19
4dul_A2e-301017017165NAC domain-containing protein 19
4dul_B2e-301017017165NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755211e-82HG975521.1 Solanum lycopersicum chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009620854.10.0PREDICTED: NAC domain-containing protein 90-like
TrEMBLK4CR451e-105K4CR45_SOLLC; Uncharacterized protein
STRINGSolyc09g010160.1.11e-105(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24942357
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.13e-78NAC domain containing protein 90